
|
| YAR062W | |||||||
| Standard Name | YAR062W | ||||||
| Description | Hypothetical ORF | ||||||
| Comment | ORF|Pseudogene | ||||||
| Organism | |||||||
| Common Name | baker's yeast | ||||||
| Scientific Name | Saccharomyces cerevisiae | ||||||
| Gene Ontology (GO) | |||||||
| Cellular Component | GO:0008372 cellular component unknown | ||||||
| Molecular Function | GO:0005554 molecular function unknown | ||||||
| Biological Process | GO:0000004 biological process unknown | ||||||
| Localization | Granular staining. * granular staining * granular staining slightly concentrated around the nuclear rim / ER | ||||||
| Sequence | |||||||
| MTGYFLPPQTSSYTFRFAKVDDSAILSVGGNVAFECCAQEQPPITSTDFT INGIKPWQGSLPDNIGGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPD GTTVSDDFEGYVYSFDDDLSQSNCTIPDPSKHTTSIVTTTTELWTGTFTS TSTEMTTVTGTNGQPTDETVIVAKAPTTATSSSLSSSSSEQITSSITS | |||||||
| Length | 198 | ||||||
| Image | |||||||
![]() | |||||||
![]() | |||||||
| Visualization | |||||||
| Organelle View | View this protein's localizations in 3D| Data Source | | SGD:S000000088 | | Anuj Kumar's lab / Mike Snyder's lab | | |
![]() |
Life Sciences Institute The University of Michigan. |