
|
| YDL134C | |||||||
| Systematic Name | YDL134C | ||||||
| Standard Name | PPH21 | ||||||
| Synonym | PPH1 | ||||||
| Description | Catalytic subunit of protein phosphatase 2A, functionally redundant with Pph22p; methylated at C terminus; forms alternate complexes with several regulatory subunits; involved in signal transduction and regulation of mitosis | ||||||
| Comment | Null mutant is viable, pph21 pph22 mutants produce very small spores in some strain backgrounds and are inviable in others, pph21 pph22 pph3 mutants are inviable | ||||||
| Organism | |||||||
| Common Name | baker's yeast | ||||||
| Scientific Name | Saccharomyces cerevisiae | ||||||
| Gene Ontology (GO) | |||||||
| Cellular Component | GO:0000159 protein phosphatase type 2A complex | ||||||
| Molecular Function | GO:0000158 protein phosphatase type 2A activity | ||||||
| Biological Process | GO:0000082 G1/S transition of mitotic cell cycle GO:0006412 protein biosynthesis GO:0006470 protein amino acid dephosphorylation GO:0007015 actin filament organization GO:0007094 mitotic spindle checkpoint GO:0007117 budding cell bud growth | ||||||
| Localization | granular staining * granular staining | ||||||
| Sequence | |||||||
| MDTDLDVPMQDAVTEQLTPTVSEDMDLNNNSSDNNAEEFSVDDLKPGSSG IADHKSSKPLELNNTNINQLDQWIEHLSKCEPLSEDDVARLCKMAVDVLQ FEENVKPINVPVTICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRG YYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSA NVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIETIDQVRELNRIQEVP HEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQDVSEQFNHTNDLSLIARA HQLVMEGYAWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNRQFLQYD PSVRPGEPSVSRKTPDYFL | |||||||
| Length | 369 | ||||||
| Image | |||||||
![]() | |||||||
![]() | |||||||
| Visualization | |||||||
| Organelle View | View this protein's localizations in 3D| Data Source | | SGD:S000002292 | | Anuj Kumar's lab / Mike Snyder's lab | | |
![]() |
Life Sciences Institute The University of Michigan. |