
|
| YDR399W | |||||||
| Systematic Name | YDR399W | ||||||
| Standard Name | HPT1 | ||||||
| Synonym | BRA6 HGPRTase HPRT | ||||||
| Full Name | hypoxanthine guanine phosphoribosyltransferase | ||||||
| Description | Dimeric hypoxanthine-guanine phosphoribosyltransferase, catalyzes the formation of both inosine monophosphate and guanosine monophosphate; mutations in the human homolog HPRT1 can cause Lesch-Nyhan syndrome and Kelley-Seegmiller syndrome | ||||||
| Organism | |||||||
| Common Name | baker's yeast | ||||||
| Scientific Name | Saccharomyces cerevisiae | ||||||
| Gene Ontology (GO) | |||||||
| Cellular Component | GO:0005634 nucleus GO:0005737 cytoplasm | ||||||
| Molecular Function | GO:0004422 hypoxanthine phosphoribosyltransferase activity | ||||||
| Biological Process | GO:0006164 purine nucleotide biosynthesis | ||||||
| Sequence | |||||||
| MSANDKQYISYNNVHQLCQVSAERIKNFKPDLIIAIGGGGFIPARILRTF LKEPGVPTIRIFAIILSLYEDLNSVGSEVEEVGVKVSRTQWIDYEQCKLD LVGKNVLIVDEVDDTRTTLHYALSELEKDAAEQAKAKGIDTEKSPEMKTN FGIFVLHDKQKPKKADLPAEMLNDKNRYFAAKTVPDKWYAYPWESTDIVF HTRMAIEQGNDIFIPEQEHKQ | |||||||
| Length | 221 | ||||||
| Image | |||||||
![]() | |||||||
| Visualization | |||||||
| Organelle View | View this protein's localizations in 3D| Data Source | | SGD:S000002807 | | Anuj Kumar's lab / Mike Snyder's lab | | |
![]() |
Life Sciences Institute The University of Michigan. |