|
| YFL014W | |||||
| Systematic Name | YFL014W | ||||
| Standard Name | HSP12 | ||||
| Synonym | GLP1 HOR5 | ||||
| Full Name | heat shock protein 12 | ||||
| Description | Plasma membrane localized protein that protects membranes from desiccation; induced by heat shock, oxidative stress, osmostress, stationary phase entry, glucose depletion, oleate and alcohol; regulated by the HOG and Ras-Pka pathways | ||||
| Comment | Null mutant is viable, but shows induction of heat shock response under conditions normally associated with low-level HSP12 expression | ||||
| Organism | |||||
| Common Name | baker's yeast | ||||
| Scientific Name | Saccharomyces cerevisiae | ||||
| Gene Ontology (GO) | |||||
| Cellular Component | GO:0005634 nucleus GO:0005737 cytoplasm GO:0005886 plasma membrane | ||||
| Molecular Function | GO:0005554 molecular function unknown | ||||
| Biological Process | GO:0006972 hyperosmotic response GO:0006979 response to oxidative stress GO:0007155 cell adhesion GO:0009269 response to desiccation GO:0009408 response to heat | ||||
| Localization | Granular staining. * * Granular staining. Some staining in only the buds. Some non-nuclear staining. * Granular staining. Some staining in only the buds. Some non-nuclear staining. | ||||
| Sequence | |||||
| MSDAGRKGFGEKASEALKPDSQKSYAEQGKEYITDKADKVAGKVQPEDNK GVFQGVHDSAEKGKDNAEGQGESLADQARDYMGAAKSKLNDAVEYVSGRV HGEEDPTKK | |||||
| Length | 109 | ||||
| Visualization | |||||
| Organelle View | View this protein's localizations in 3D| Data Source | | SGD:S000001880 | | |
