|
| YGL087C | |||||||
| Systematic Name | YGL087C | ||||||
| Standard Name | MMS2 | ||||||
| Description | Protein involved in error-free postreplication DNA repair; forms a heteromeric complex with Ubc13p that has a ubiquitin-conjugating activity; cooperates with chromatin-associated RING finger proteins, Rad18p and Rad5p | ||||||
| Comment | Null mutant is viable and is sensitive to MMS and UV | ||||||
| Organism | |||||||
| Common Name | baker's yeast | ||||||
| Scientific Name | Saccharomyces cerevisiae | ||||||
| Gene Ontology (GO) | |||||||
| Cellular Component | GO:0005634 nucleus GO:0005737 cytoplasm GO:0031371 ubiquitin conjugating enzyme complex | ||||||
| Molecular Function | GO:0004840 ubiquitin conjugating enzyme activity (contributes to) | ||||||
| Biological Process | GO:0000209 protein polyubiquitination GO:0006301 postreplication repair GO:0006974 response to DNA damage stimulus | ||||||
| Localization | granular staining; some exclusion of staining in the nucleus | ||||||
| Sequence | |||||||
| MSKVPRNFRLLEELEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPH SNHENRIYSLSIDCGPNYPDSPPKVTFISKINLPCVNPTTGEVQTDFHTL RDWKRAYTMETLLLDLRKEMATPANKKLRQPKEGETF | |||||||
| Length | 137 | ||||||
| Image | |||||||
 | |||||||
| Visualization | |||||||
| Organelle View | View this protein's localizations in 3D| Data Source | | SGD:S000003055 | | Anuj Kumar's lab / Mike Snyder's lab | | |
