|
| YGR167W | |||||||
| Systematic Name | YGR167W | ||||||
| Standard Name | CLC1 | ||||||
| Synonym | SCD4 | ||||||
| Full Name | clathrin light chain | ||||||
| Description | Clathrin light chain, subunit of the major coat protein involved in intracellular protein transport and endocytosis; thought to regulate clathrin function, two Clathrin heavy chains (CHC1) form the clathrin triskelion structural component | ||||||
| Comment | Null mutant is viable but slow-growing and shows defects in receptor-mediated endocytosis, maturation of alpha factor and levels of clathrin heavy chain (Chc1p); high copy suppresses the inviable double mutant chc1-delete, scd1-i-allele; elevated CHC1 expression suppresses some clc1-delete phenotypes | ||||||
| Organism | |||||||
| Common Name | baker's yeast | ||||||
| Scientific Name | Saccharomyces cerevisiae | ||||||
| Gene Ontology (GO) | |||||||
| Cellular Component | GO:0030125 clathrin vesicle coat | ||||||
| Molecular Function | GO:0005198 structural molecule activity | ||||||
| Biological Process | GO:0006897 endocytosis GO:0016192 vesicle-mediated transport | ||||||
| Sequence | |||||||
| MSEKFPPLEDQNIDFTPNDKKDDDTDFLKREAEILGDEFKTEQDDILETE ASPAKDDDEIRDFEEQFPDINSANGAVSSDQNGSATVSSGNDNGEADDDF STFEGANQSTESVKEDRSEVVDQWKQRRAVEIHEKDLKDEELKKELQDEA IKHIDDFYDSYNKKKEQQLEDAAKEAEAFLKKRDEFFGQDNTTWDRALQL INQDDADIIGGRDRSKLKEILLRLKGNAKAPGA | |||||||
| Length | 233 | ||||||
| Image | |||||||
 | |||||||
| Visualization | |||||||
| Organelle View | View this protein's localizations in 3D| Data Source | | SGD:S000003399 | | Anuj Kumar's lab / Mike Snyder's lab | | |
