|
| YLR150W | |||||||
| Systematic Name | YLR150W | ||||||
| Standard Name | STM1 | ||||||
| Synonym | MPT4 | ||||||
| Full Name | purine motif triplex-binding protein | ||||||
| Description | Protein that binds G4 quadruplex and purine motif triplex nucleic acid; acts with Cdc13p to maintain telomere structure; interacts with ribosomes and subtelomeric Y' DNA; multicopy suppressor of tom1 and pop2 mutations | ||||||
| Comment | Null mutant is viable; overexpression of STM1 suppresses some phenotypes of pop2 null mutations and the temperature sensitivity of tom1 and htr1 mutants. Cells lacking Stm1 display deficiency in the apoptosis-like cell death process induced by treatment with low concentrations of H2O2. Survival is increased when Stm1 is completely missing from the cells or when inhibition of Stm1 synthesis permits proteasomal degradation to decrease its amount in the cell. Stm1 accumulation induces cell death. | ||||||
| Organism | |||||||
| Common Name | baker's yeast | ||||||
| Scientific Name | Saccharomyces cerevisiae | ||||||
| Gene Ontology (GO) | |||||||
| Cellular Component | GO:0000783 nuclear telomere cap complex GO:0005737 cytoplasm | ||||||
| Molecular Function | GO:0042162 telomeric DNA binding | ||||||
| Biological Process | GO:0000723 telomere maintenance GO:0006916 anti-apoptosis | ||||||
| Localization | Granular staining. * some staining towards the cell periphery | ||||||
| Sequence | |||||||
| MSNPFDLLGNDVEDADVVVLPPKEIVKSNTSSKKADVPPPSADPSKARKN RPRPSGNEGAIRDKTAGRRNNRSKDVTDSATTKKSNTRRATDRHSRTGKT DTKKKVNQGWGDDKKELSAEKEAQADAAAEIAEDAAEAEDAGKPKTAQLS LQDYLNQQANNQFNKVPEAKKVELDAERIETAEKEAYVPATKVKNVKSKQ LKTKEYLEFDATFVESNTRKNFGDRNNNSRNNFNNRRGGRGARKGNNTAN ATNSANTVQKNRNIDVSNLPSLA | |||||||
| Length | 273 | ||||||
| Image | |||||||
 | |||||||
| Visualization | |||||||
| Organelle View | View this protein's localizations in 3D| Data Source | | SGD:S000004140 | | Anuj Kumar's lab / Mike Snyder's lab | | |
